} "action" : "rerender" -> Have a look at this full list. "context" : "envParam:entity", "event" : "addMessageUserEmailSubscription", "context" : "envParam:quiltName,message,product,contextId,contextUrl", "event" : "ProductAnswerComment", } { "}); "actions" : [ var divContainer = $(''); "action" : "rerender" "action" : "rerender" But what if one is behind NAT, or even both? "selector" : "#messageview_2", }, "eventActions" : [ "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_71a53c35a6f0a","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_71a53c35a6f0a_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/thread-id/45609&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"UrP_mAxGNj09jvVoX82nXk9-Md-pax2ZvzAvLZ5I9Eo. "context" : "envParam:quiltName", "parameters" : { }); First, log into the web interface of the MX firewall that you want to configure. } "event" : "unapproveMessage", "disableLinks" : "false", "action" : "rerender" You can hire him on. Unlike Site-to-Site, PTP is considered a legacy VPN technology that is less secure than modern VPN solutions. LITHIUM.AjaxSupport.ComponentEvents.set({ "event" : "ProductAnswer", "action" : "pulsate" "actions" : [ { "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ You can, training course on Cisco Meraki Firewalls. { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", { { { You then use the source NAT transition that@GreenMantalked about on the Azure VMX. Which mean when the IPSec encapsulated packet arrived on your WAN interface (e.g. "action" : "rerender" })(LITHIUM.jQuery); }, { ] By submitting this form you agree to receive marketing emails from CBT Nuggets and that you have read, understood and are able to consent to our privacy policy. }, That's because a hub connection will connect all existing parts of a network together. { "revokeMode" : "true", A Site-to-Site encrypts data transferred between users or different locations, safeguarding confidential information and keeping it in trusted hands. Site-to-site VPNs connect several LANs securely, whereas Point-to-point (PTP) is a traditional VPN protocol that connects particular devices. }, "initiatorDataMatcher" : "data-lia-kudos-id" }, The following was needed: "context" : "", Only the remote site routers are aware of the headquarter's public IP address (74.200.90.5) because it is static, and therefore only the remote router can initiate the VPN tunnel. WAN Interface connected to public internet which have the crypto map assigned: interface GigabitEthernet8ip address x.x.x.x 255.255.255.248ip access-group ACLWAN induplex autospeed autono cdp enablecrypto map CRYP_MAP, LAN Interface connected to target network: (where i can not set a default gateway on the devices, therefore NAT must be used), interface Vlan1ip address 10.20.60.12 255.255.254.0ip nat outsideip virtual-reassembly in, ip access-list standard ACL-NATpermit a.a.a.a 0.0.0.15permit192.168.80.0 0.0.0.15, 192.168.80.0 = subnet used by the remote end of the Site to Site IPSec Tunnel, interface: GigabitEthernet8Crypto map tag: CRYP_MAP, local addr x.x.x.x, protected vrf: (none)local ident (addr/mask/prot/port): (10.20.60.0/255.255.254.0/0/0)remote ident (addr/mask/prot/port): (192.168.80.0/255.255.255.240/0/0). You may choose another option from the dropdown menu. { { { "action" : "rerender" { "action" : "rerender" "truncateBody" : "true", "messageViewOptions" : "1111110111111111111110111110100101011101", "action" : "rerender" "showCountOnly" : "false", Are you sure you want to proceed? }, "context" : "envParam:entity", "action" : "pulsate" { LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper_1","messageId":196414,"messageActionsId":"messageActions_1"},"isRootMessage":false,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. Prerequisites Requirements There are no specific requirements for this document. LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_71a53c35a6f0a', 'enableAutoComplete', '#ajaxfeedback_71a53c35a6f0a_0', 'LITHIUM:ajaxError', {}, 'iJy9uFVwkQtxIIcsR8hpQQNevZdkcNwuOHYu-4Ovggw. "actions" : [ "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_3","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_3","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/thread-id/45609&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"EaRd1hwS5dzlfsfoJS59i0TS28F_cU-tjVouUjgZquw. "action" : "rerender" You crypto-definition has to use the 10.10.10-network, not the 192.168.10. { } { } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox","feedbackSelector":".InfoMessage"}); "action" : "rerender" "context" : "envParam:quiltName,product,contextId,contextUrl", } ] Exclude VPN traffic from NAT Overload. "event" : "ProductMessageEdit", ] }, "useTruncatedSubject" : "true", }); $('.spinner', divContainer).remove(); }, } ] "context" : "envParam:quiltName,message,product,contextId,contextUrl", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); }, success: function(data) { All Rights Reserved. { "displaySubject" : "true" }, "event" : "MessagesWidgetMessageEdit", Components Used } "}); The information in this document is based on a Cisco router with Cisco IOS Release 15.7. "event" : "QuickReply", }, LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" { "event" : "markAsSpamWithoutRedirect", The difference between a Site-to-Site and remote access VPN is simple. }); "initiatorBinding" : true, }, "kudosable" : "true", }, "useSortHeader" : "false", For media inquiries, please contact-[emailprotected], Have a question? "actions" : [ Here is the details of each commands used above, Step 2. A VPN connection can achieve that by creating a secure tunnel over the public internet between both locations. } "truncateBodyRetainsHtml" : "false", "action" : "rerender" "event" : "MessagesWidgetEditCommentForm", ] }, }, "actions" : [ { ] "context" : "envParam:quiltName", I have seen this done using a VMX in Azure (and this is a hard requirement). }, "useCountToKudo" : "false", "disallowZeroCount" : "false", "useTruncatedSubject" : "true", ] ] Even though they work across multiple places geographically, there needs to be a single encrypted connection between them for secure communication. "}); ] }, LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper","componentSelector":"#threadeddetaildisplaymessageviewwrapper","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":196413,"confimationText":"You have other message editors open and your data inside of them might be lost. "eventActions" : [ "context" : "envParam:quiltName,expandedQuiltName", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", ], LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ "context" : "envParam:quiltName", } "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "event" : "approveMessage", } ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_1 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); You will still need to configure additional security settings at each firewall separately. "action" : "pulsate" LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_71a53c540875c', 'disableAutoComplete', '#ajaxfeedback_71a53c35a6f0a_0', 'LITHIUM:ajaxError', {}, 'TX_ritBbhYvLU_YWhFiTvbrMQfOBrLKb3_xKf66Psdo. LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown","menuItemsSelector":".lia-menu-dropdown-items"}}); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:sortLabelsWidget","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#labelsTaplet","action":"sortLabelsWidget","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.labelstaplet:sortlabelswidget?t:ac=board-id/security/thread-id/45609&t:cp=labels/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"6k7HPZQXXKVVyYUxbP2h1HrgVkg-pY11wv9a-nwtfdw. Quick Setup > VPN Setup Wizard > Welcome > Wizard Type > VPN Settings > Wizard Completed. "initiatorBinding" : true, }, } "actions" : [ { In this post, I will show steps to Configure Site to Site IPSec VPN Tunnel in Cisco IOS Router . After making your selection, a new set of options will appear. "event" : "expandMessage", }, "context" : "envParam:selectedMessage", ] "action" : "addClassName" When using NAT, the NAT process takes place before the encryption process, by the time the traffic arrives at the crypto map ACL, it looks like it is from 4.5.6.7/30 network going . { { 05:58 AM. 2012 - 2021 MustBeGeek. ] }, }, "event" : "RevokeSolutionAction", ] ] ] }, "disableLabelLinks" : "false", } Vice-versa, when the return packet is arrived on LAN interface, NAT is performed before IPSec encryption. It's not uncommon for small or medium-sized businesses to have multiple locations. "forceSearchRequestParameterForBlurbBuilder" : "false", { } It's about the order of operation, NAT is performed after IPSec decryption. Site-to-site virtual private networks (VPNs) are frequently used by companies with multiple offices in different geographic locations that need regular access to the corporate network. "selector" : "#messageview_3", "}); ] ] LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_0","componentSelector":"#threadeddetaildisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":196414,"confimationText":"You have other message editors open and your data inside of them might be lost. ] { "action" : "rerender" "action" : "rerender" "disableKudosForAnonUser" : "false", ] LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_4","menuItemsSelector":".lia-menu-dropdown-items"}}); "context" : "", "context" : "envParam:quiltName,message,product,contextId,contextUrl", Then, it will performed NAT (source: 192.168.80.x -> [overload NAT] 10.20.60.12; destination: 10.20.60.x). ] $(this).on('click', function() { GigabitEthernet8), it will first be decrypted (source: 192.168.80.x, destination: 10.20.60.x). "context" : "", { }); "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", $(divContainer).addClass('hc-animate-in hc-is-shown'); LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#pageInformation","feedbackSelector":".InfoMessage"}); { \\n\\t\\t\\t\\n\\t\\n\\n\\t\\n\\n\\t\\t\";LITHIUM.AjaxSupport.defaultAjaxErrorHtml = \", \\n\\t\\t\\t\\t\\n\\n\\t\\t\\t\\t\\n\\t\\t\\t\\t\\t, Cloud Monitoring for Catalyst - Early Availability Group, https://documentation.meraki.com/MX/Site-to-site_VPN/Using_Site-to-site_VPN_Translation, Recognizing the May 2023 Members of the Month. { "eventActions" : [ They are RFC 1918 addresses which have been used in a lab environment. Make sure you have ticked the 'Enable'. "context" : "", ] function makeid() "event" : "MessagesWidgetEditAction", ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, "action" : "pulsate" { "event" : "addThreadUserEmailSubscription", { "event" : "ProductAnswer", } When you configure a site-to-site VPN connection for Cisco MX firewalls, you are given the option of creating a Hub or Spoke connection. By providing secure data transfer between users based on pre-approved authorization, vital resources are accessible to those who need themwithout any roadblocks. "action" : "rerender" Are you sure you want to proceed? )*safari/i.test(navigator.userAgent)) { { The following two tabs change content below. } } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); } { So definitely need a destination NAT feature. "action" : "rerender" }, }, "context" : "", "action" : "pulsate" As we mentioned, though, a spoke VPN only connects two hubs together. $search.find('input.search-input').keyup(function(e) { { }); "event" : "ProductMessageEdit", Note: The IP addressing schemes used in this configuration are not legally routable on the Internet. } ], "action" : "rerender" "context" : "envParam:quiltName,message,product,contextId,contextUrl", 08-31-2020 <- { Here is the detail of command used above. { "event" : "kudoEntity", I am showing the screenshots/listings as well as a few troubleshooting commands. "action" : "rerender" "action" : "rerender" "context" : "", With site-to-site VPNs LAN-to-LAN traffic does not need to be translated. I guess, if this is important enough and you wanted it just for a handful of devices, you'd move those to a dedicated 'translation VLAN'. ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","menuBarComponent":"lia-component-menu-bar","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-component-community-widget-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); "action" : "addClassName" "}); }, "event" : "approveMessage", "actions" : [ $(this).append(divContainer); "useSubjectIcons" : "true", "eventActions" : [ "actions" : [ ] "actions" : [ "event" : "addMessageUserEmailSubscription", "truncateBody" : "true", "action" : "rerender" ] "action" : "rerender" "initiatorDataMatcher" : "data-lia-kudos-id" }, "context" : "", If you are interested in learning more about the Cisco MX line of devices, consider taking a complete training course on Cisco Meraki Firewalls. $('.hc-user-profile').removeClass('hc-animate-in hc-is-shown'); ', 'ajax'); { "parameters" : { "truncateBody" : "true", Why would you use a spoke connection over a mesh VPN connection? "disableLabelLinks" : "false", }, "event" : "QuickReply", You can NAT overload behind the interface the VPN is established on. "context" : "", "event" : "approveMessage", } { ] "action" : "rerender" ;(function($){ { "message" : "196414", "action" : "rerender" "selector" : "#kudosButtonV2", So, repeat the steps above for each MX firewall hub in your various business networks. } "event" : "MessagesWidgetEditAnswerForm", "eventActions" : [ "forceSearchRequestParameterForBlurbBuilder" : "false", Secure company data, resources, and all network users with SASE. This process does not actually configure firewall rules or any other security settings. ] "initiatorBinding" : false, Auto-suggest helps you quickly narrow down your search results by suggesting possible matches as you type. ","messageActionsSelector":"#messageActions_2","loaderSelector":"#loader","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_2","loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false,"linearDisplayViewSelector":".lia-linear-display-message-view","threadedDetailDisplayViewSelector":".lia-threaded-detail-display-message-view","replyEditorPlaceholderWrapperSelector":".lia-placeholder-wrapper","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","isLazyLoadEnabled":false,"layoutView":"threaded","isAllowAnonUserToReply":true,"replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true}); This document describes the new, high-availability features for site-to-site IPSec VPN networks. { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "event" : "MessagesWidgetEditAnswerForm", Looks like the SonicWall has some NAT policies that could work with the Cisco device to . Paul Kroon above mentioned a couple of workarounds. "initiatorDataMatcher" : "data-lia-kudos-id" var unqId = makeid(); } ] ] "useSubjectIcons" : "true", LITHIUM.Placeholder(); Dont forget to ping from inside IP address while testingthe VPN tunnel from the router. "selector" : "#messageview_0", "componentId" : "kudos.widget.button", "messageViewOptions" : "1101110111111111111110111110100101111101", To verify the IPSec Phase 1 connection, type show crypto isakmp sa as shown below. IPSec encryption is then performed if(source: 10.20.60.x, destination: 192.168.80.x) hit the crypto map condition. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/thread-id/45609&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"zZ6gZ2zWOMqjXAjuFCbzPuRTSuvzKx_goMeeTB8Hots. }, } (adsbygoogle = window.adsbygoogle || []).push({}); IPSec VPN is a security feature that allow you to create secure communication link (also called VPN Tunnel) between two different networks located at different sites. "event" : "MessagesWidgetAnswerForm", "displayStyle" : "horizontal", "event" : "MessagesWidgetEditAnswerForm", I have read and understood the privacy policy and am able to consent to it. ] "parameters" : { This is one of the most complicated configurations in all of security appliance configurations. Description A VPN tunnel cannot be established if both the destination network and the local network have the same subnets. console.log('Submitting header search form'); ] You may choose another option from the dropdown menu. ], "kudosLinksDisabled" : "false", "kudosLinksDisabled" : "false", LITHIUM.PartialRenderProxy({"limuirsComponentRenderedEvent":"LITHIUM:limuirsComponentRendered","relayEvent":"LITHIUM:partialRenderProxyRelay","listenerEvent":"LITHIUM:partialRenderProxy"}); "context" : "envParam:viewOrderSpec", LITHIUM.SearchAutoCompleteToggle({"containerSelector":"#searchautocompletetoggle_71a53c35a6f0a","enableAutoCompleteSelector":".search-autocomplete-toggle-link","enableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:enableAutoComplete","disableAutoCompleteSelector":".lia-autocomplete-toggle-off","disableAutocompleteSuccessEvent":"LITHIUM:ajaxSuccess:disableAutoComplete","autoCompleteSelector":".lia-autocomplete-input"}); "actions" : [ ] "actions" : [ "event" : "removeMessageUserEmailSubscription", { }, ] LITHIUM.SearchForm({"asSearchActionIdSelector":".lia-as-search-action-id","useAutoComplete":true,"selectSelector":".lia-search-form-granularity","useClearSearchButton":false,"buttonSelector":".lia-button-searchForm-action","asSearchActionIdParamName":"as-search-action-id","formSelector":"#lia-searchformV32_71a53c35a6f0a","nodesModel":{"tkb|tkb":{"title":"Knowledge base","inputSelector":".lia-search-input-tkb-article"},"security|forum-board":{"title":"Search Board: Security / SD-WAN","inputSelector":".lia-search-input-message"},"meraki|category":{"title":"Search Community: Security / SD-WAN","inputSelector":".lia-search-input-message"},"enterprise|category":{"title":"Search Category: Security / SD-WAN","inputSelector":".lia-search-input-message"},"user|user":{"title":"Users","inputSelector":".lia-search-input-user"}},"asSearchActionIdHeaderKey":"X-LI-AS-Search-Action-Id","inputSelector":"#messageSearchField_71a53c35a6f0a_0:not(.lia-js-hidden)","clearSearchButtonSelector":null}); } "event" : "MessagesWidgetAnswerForm", { { "event" : "ProductMessageEdit", { "context" : "envParam:selectedMessage", { ] ] So employees could use those services to share files with each other. "actions" : [ "actions" : [ return text; To verify IPSec Phase 2 connection, type show crypto ipsec sa as shown below. } $search.addClass('is--open'); { { 05:56 AM "showCountOnly" : "false", ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_2 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); { "actions" : [ "event" : "ProductMessageEdit", { "context" : "", "initiatorBinding" : true, The two sites have static public IP address as shown in the diagram. } "event" : "kudoEntity", }, "disableLinks" : "false", if ($(this).parents('.lia-component-users-widget-menu').length > 0) { Cisco 1800 Series Integrated Services Routers, Technical Support & Documentation - Cisco Systems, Name of the crypto map and sequence number, Name of the ACL applied along with the local and remote proxy identities, Interface on which the crypto map is binded. // -->. "actions" : [ "actions" : [ 08-31-2020 }, { "useTruncatedSubject" : "true", ] { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } - edited { Integration is Key to Security. LITHIUM.AjaxSupport.ComponentEvents.set({ "actions" : [ 1:in crypto map VPN 10,how does it map to the crypto isakmp policy? I have already verified that both routers can ping each other so lets start the VPN configuration. }, configure NAT-T in PAT firewall 7800 or ASA? '); On the 'Site-to-site VPN' configuration page, you will see three different options: Select either Hub or Spoke from that list depending on how you want to configure our site-to-site VPN. "action" : "rerender" "context" : "", }, By enabling a speedy and consistent flow of data traffic, Site-to-Site optimizes network performance and keeps day-to-day operations running smoothly. "action" : "rerender" "action" : "rerender" "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"useLoader":true,"blockUI":"","event":"LITHIUM:reRenderInlineEditor","parameters":{"clientId":"inlinemessagereplyeditor_0"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"reRenderInlineEditor","feedbackSelector":"#inlinemessagereplyeditor_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:rerenderinlineeditor?t:ac=board-id/security/thread-id/45609","ajaxErrorEventName":"LITHIUM:ajaxError","token":"cRALYKG4Q9gY8ALQCdAak9oDk358n2XBhut-AB9YBlo. Find answers to your questions by entering keywords or phrases in the Search bar above. }, { "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "truncateBodyRetainsHtml" : "false", "event" : "kudoEntity", "actions" : [ { "selector" : "#kudosButtonV2_3", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", }, }, { ] "parameters" : { "context" : "envParam:quiltName,expandedQuiltName", "actions" : [ "message" : "196413", LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$('',{method:'POST',action:$link.attr('href'),enctype:'multipart/form-data'});var $ticket=$('',{type:'hidden',name:'lia-action-token',value:token});$form.append($ticket);$(document.body).append($form);$form.submit();$doc.trigger('click');}}}\nif($doc.data('lia-link-action-handler')===undefined){$doc.data('lia-link-action-handler',true);$doc.on('click.link-action',params.linkSelector,handler);$.fn.on=$.wrap($.fn.on,function(proceed){var ret=proceed.apply(this,$.makeArray(arguments).slice(1));if(this.is(document)){$doc.off('click.link-action',params.linkSelector,handler);proceed.call(this,'click.link-action',params.linkSelector,handler);}\nreturn ret;});}}})(LITHIUM.jQuery);\r\n\nLITHIUM.Link({\n \"linkSelector\" : \"a.lia-link-ticket-post-action\"\n});LITHIUM.AjaxSupport.fromLink('#disableAutoComplete_71a53c579bf60', 'disableAutoComplete', '#ajaxfeedback_71a53c35a6f0a_0', 'LITHIUM:ajaxError', {}, 'j6X7TSj8jfGmuKf-GCi7cbttqrRYxso_tVFzfQvEvHw. "entity" : "196419", "actions" : [ LITHIUM.AjaxSupport.fromLink('#kudoEntity', 'kudoEntity', '#ajaxfeedback', 'LITHIUM:ajaxError', {}, '39Dj_PAA72nYy5XUh1STWqGrO9YJQRZeyz3AOa9xxP0. So, if it's well configured, it should work as expected. A Site-to-Site VPN work as secure tunnels protecting traffic from outside userswhether the exchanges of data packets are happening across an internal network or externally with trusted third-party organizations. "event" : "MessagesWidgetMessageEdit", LITHIUM.ThreadedDetailMessageList({"renderLoadMoreEvent":"LITHIUM:renderLoadMoreMessages","loadingText":"Loading","placeholderClass":"lia-messages-threadedDetailList-placeholder","loadFetchSelector":"#threadeddetailmessagelist .lia-load-fetch","rootMessageId":196411,"loadPageNumber":1}); "forceSearchRequestParameterForBlurbBuilder" : "false", } Your configuration look good to me exceptthe interface Gig8. Then click on 'Site-to-Site VPN.'. } Remote spokes then see the new NATed subnet to talk to. "quiltName" : "ForumMessage", { LITHIUM.AjaxSupport.fromLink('#kudoEntity_1', 'kudoEntity', '#ajaxfeedback_1', 'LITHIUM:ajaxError', {}, '9TDVpqho2zyUwWw7M0QQSJB65RnKXDeYLkEEWiXvL9M. ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); Once you are logged into the web interface, click the 'Security and SD-WAN' option from the navigation panel on the left-hand side of the website. "context" : "envParam:entity", }, "actions" : [ ] { ] "event" : "AcceptSolutionAction", ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_71a53c35a6f0a_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/thread-id/45609&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }); "disallowZeroCount" : "false", $search.find('form.SearchForm').on('submit', function(e) { "actions" : [ "componentId" : "kudos.widget.button", Hot Standby Router Protocol (HSRP) is often used to track routers' interface status to achieve failover between routers. }, Bipin is a freelance Network and System Engineer with expertise on Cisco, Juniper, Microsoft, VMware, and other technologies. "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", // if (!$search.is(e.target) && $search.has(e.target).length === 0) { { { }, "truncateBody" : "true", ] { { "revokeMode" : "true", { Creating a site-to-site VPN with Cisco MX firewalls is now super easy. "linkDisabled" : "false" } if ( e.keyCode === 13 ) { { "event" : "unapproveMessage", "action" : "pulsate" } "context" : "envParam:quiltName", "actions" : [ "actions" : [ LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_13","feedbackSelector":".InfoMessage"}); } }, Yeah sorry - I know subnet translation is the only production feature that's anything like what you're asking for so linked it quickly, before reading about your need to also NAT the destination addr. "action" : "rerender" { }, Overview Readers will learn how to configure a Policy-Based Site-to-Site IPsec VPN between an EdgeRouter and a Cisco ISR. "event" : "MessagesWidgetCommentForm", } "action" : "rerender" "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_2","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/thread-id/45609&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"TioBlNxckaRhVFAqocCulECCVvLjoehykvXSVOaGq4I. This ACL will be usedin Step 4 in Crypto Map. "action" : "rerender" } { }, Thankfully, Ciscohas made that process easy. { "event" : "deleteMessage", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper_2","messageId":196419,"messageActionsId":"messageActions_2"},"isRootMessage":false,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "context" : "lia-deleted-state", "event" : "addMessageUserEmailSubscription", }, ] Step 1. ] ] ], "actions" : [ "context" : "lia-deleted-state", The other is to do double NAT: Source NAT the office to 10.1.0.0 and DC to 10.2.0.0. obj-10.10.10.x destination static REMOTE-NET REMOTE-NET. { "event" : "MessagesWidgetAnswerForm", { With intranet-based VPNs, the individual teams within a company are connected across the internet by sharing the same network. { } To test the VPN connection lets ping from R1 to PC2. Remote Access VPNs work simultaneously but connect mobile devices to a remote LAN. }, }, } "event" : "removeThreadUserEmailSubscription", "actions" : [ var text = ""; "action" : "rerender" LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/security/thread-id/45609","ajaxErrorEventName":"LITHIUM:ajaxError","token":"we5bcOwI837GmGoHEHUQ-W5stkIWvQc3fKvWuEf5A9Y. "messageViewOptions" : "1111110111111111111110111110100101011101", "eventActions" : [ This wouldn't be possible without a VPN connection between those two locations. { "context" : "", { The FortiGate is configured via the GUI - the router via the CLI. Then click on 'Site-to-Site VPN.'. "actions" : [ { "context" : "envParam:feedbackData", "parameters" : { This VPN is on a IOS router? return; LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/45609","ajaxErrorEventName":"LITHIUM:ajaxError","token":"bf7DuCE-pQEbCJWyTjog3B3YlJNvzpsJKaKUkxttv2Q. There are no specific requirements for this document. ] { "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/thread-id/45609&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"MGWh-UVFLmrmE1ZIrgJPnMZfXmLhXdI_eGvawBO8eW8. "}); Create separate private gateways firstthese VPN gateways are entry points into your network. Configuring site-to-site VPNs with a Cisco MX firewall is easy. ] }, "event" : "editProductMessage", }) { "actions" : [ }, "actions" : [ Site-to-site virtual private networks (VPNs) are frequently used by companies with multiple offices in different geographic locations that need regular access to the corporate network. } { Vice-versa, when the return packet is arrived on LAN interface, NAT is performed, Customers Also Viewed These Support Documents. { } "event" : "QuickReply", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper_2","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/thread-id/45609","ajaxErrorEventName":"LITHIUM:ajaxError","token":"ZpENvFpLk0wJdgWCyOTQsiP7gMe-3Q8wvgRxm2dg7U4. // Detect safari =(, it does not submit the form for some reason LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_71a53c35a6f0a","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_71a53c35a6f0a_0","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield:userexistsquery?t:ac=board-id/security/thread-id/45609&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"UrP_mAxGNj09jvVoX82nXk9-Md-pax2ZvzAvLZ5I9Eo. Exceptions may be present in the documentation due to language that is hardcoded in the user interfaces of the product software, language used based on RFP documentation, or language that is used by a referenced third-party product. "context" : "envParam:quiltName,expandedQuiltName", You can also setup Configure IPSec VPN With Dynamic IP in Cisco IOS Router. $search.find('.lia-cancel-search').on('click', function() { }, "event" : "deleteMessage", ] { When you configure a Cisco MX firewallto use a Hub site-to-site VPN, that Meraki firewall will connect to all other Hubs in the network. Don't forget that this process only configures the site-to-site VPN between two or more Cisco MX firewalls, though. }); } }, "action" : "rerender" Configure IPSec VPN With Dynamic IP in Cisco IOS Router, Understanding how MPLS Works in Cisco IOS Router, Redistribute OSPF Route into BGP in Cisco IOS Router, Redistribute BGP Route into OSPF in Cisco IOS Router, Redistribute Static Route into EIGRP in Cisco IOS Router, Distribute Static Route via OSPF in Cisco IOS Router, Install Exchange 2019 in Windows Server 2019, Steps to Configure IP Address and Hostname in vSphere ESXi 7, How to Move Documents Folder in Windows 10, Configure External and Internal URL in Exchange 2016, Configure External and Internal URL in Exchange 2013, Cutover Migration from Exchange 2016 to Office 365 (Part 2). { "action" : "rerender" "actions" : [ "action" : "rerender" "actions" : [ ] "action" : "rerender" beforeSend: function() {}, "context" : "envParam:quiltName,product,contextId,contextUrl", Phase 2: VPN > IPSec VPN > VPN Connection. }, } This blog post shows how to configure a site-to-site IPsec VPN between a FortiGate firewall and a Cisco router. "initiatorDataMatcher" : "data-lia-kudos-id" The Apply NAT Policies feature or NAT over VPN is configured when both sides of a proposed site to site VPN configuration have identical, and hence overlapping, subnets. "actions" : [ }, { "actions" : [ }, }, LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#productSearchField_71a53c35a6f0a","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.productsearchfield.productsearchfield:autocomplete?t:ac=board-id/security/thread-id/45609&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "context" : "", { LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_1","menuItemsSelector":".lia-menu-dropdown-items"}}); { { "disableKudosForAnonUser" : "false", { { ] "action" : "rerender" "disableLinks" : "false", }, LITHIUM.DropDownMenu({"userMessagesFeedOptionsClass":"div.user-messages-feed-options-menu a.lia-js-menu-opener","menuOffsetContainer":".lia-menu-offset-container","hoverLeaveEvent":"LITHIUM:hoverLeave","mouseoverElementSelector":".lia-js-mouseover-menu","userMessagesFeedOptionsAriaLabel":"Show contributions of the user, selected option is Show MX device Destination NAT post option menu. } "event" : "RevokeSolutionAction", Refer to the Cisco Technical Tips Conventions for more information on document conventions. ] "context" : "", "event" : "MessagesWidgetCommentForm", ] "actions" : [ "context" : "", (inside) PIX (outside) ------------ (LAN PORT) LINKSYS (WAN PORT) ------------- (outside) ASA (inside) One vpn endpoint (pix) is behind a NAT device (linksys). ] "event" : "ProductAnswer", { "action" : "rerender" } "action" : "rerender" LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); var possible = "ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789"; "context" : "", "context" : "", LITHIUM.Auth.LOGIN_URL_TMPL = '/plugins/common/feature/saml/doauth/post?referer=https%3A%2F%2FREPLACE_TEXT'; LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_1","feedbackSelector":".InfoMessage"}); "context" : "", { https://documentation.meraki.com/MX/Site-to-site_VPN/Using_Site-to-site_VPN_Translation, Note that this would apply to all hosts within the configured VLAN. I need to do a destination NAT on the MX to avoid routing issues across VPN/Azure. "context" : "envParam:quiltName,message,product,contextId,contextUrl", As you can see, the ping from R1 to PC2 is successful. Configure Site to Site IPSec VPN Tunnel in Cisco IOS Router Diagram below shows our simple scenario. "action" : "rerender" }, } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); ] Both services include file sharing and syncing services. "action" : "pulsate" }, ] { "event" : "removeMessageUserEmailSubscription", "displayStyle" : "horizontal", "action" : "addClassName" "action" : "rerender" { "displayStyle" : "horizontal", "actions" : [ "context" : "envParam:quiltName", ] LITHIUM.Placeholder(); NordLayer works by improving security at every layer of the hybrid cloud environment. } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_3","menuItemsSelector":".lia-menu-dropdown-items"}}); "event" : "unapproveMessage", "includeRepliesModerationState" : "true", "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } }); }, ] ] "action" : "pulsate" ] That process creates a connection that data can only travel in one direction with. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_8","feedbackSelector":".InfoMessage"}); "actions" : [ "action" : "rerender" "action" : "pulsate" The shift to cloud computing and remote work saw companies rapidly adopt networking technologies to accommodate safe workingregardless of their employees geographical location. which mean the packet (source 10.20.60.x, destination: 10.20.60.12) will translate to (source: 10.20.60.x, destination: 192.168.80.x). { "quiltName" : "ForumMessage", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_12","feedbackSelector":".InfoMessage"}); "actions" : [ You can also setup Configure IPSec VPN With Dynamic IP in Cisco IOS Router. ] Configuring IPSec Phase 2 (Transform Set). }, } ] }, Whereas Secure Access Service Edge (SASE) encompasses numerous solutions - including VPNs - allowing organizations to implement zero-trust network access policies that protect all users on and off-site, including remote workers. "action" : "rerender" "actions" : [ "actions" : [ "actions" : [ { "useSubjectIcons" : "true", The Cisco CLI Analyzer (registered customers only) supports certain show commands. { They work as secure VPN tunnels between two or more networks, providing safe pathways to exchange private dataaway from outside users. NOTES & REQUIREMENTS: Applicable to the latest EdgeOS firmware on all EdgeRouter models. }, { text += possible.charAt(Math.floor(Math.random() * possible.length)); 7. By using a site-to-site VPN, different geographically located offices can communicate with each other, thinking they are connected to the same physical network. "linkDisabled" : "false" ] { "kudosable" : "true", Apply Crypto Map to outgoing interface. "event" : "MessagesWidgetEditAnswerForm", } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_0","menuItemsSelector":".lia-menu-dropdown-items"}}); { This is working fine with a L2TP IPSec "dialin" type of VPN as there I have a interface Virtual-Template1 which i can configure as nat inside. "action" : "rerender" } { Signing up takes only a few minutes through our simple registration process. { "action" : "rerender" }, type: 'post', You can also view active IPSec sessions using show crypto session command as shown below. "event" : "ProductAnswerComment", "action" : "rerender" }, { "action" : "rerender" { "action" : "rerender" "action" : "rerender" ] } "actions" : [ "initiatorDataMatcher" : "data-lia-message-uid" } 3. ] "event" : "editProductMessage", "actions" : [ That's because the other firewalls do not yet know to allow traffic to flow back the other direction through the VPN. ] '; }, "actions" : [ After you configure all your networks that need to be connected with that VPN connection, you are done. Above ACL 101will exclude interesting traffic from NAT. } LITHIUM.InlineMessageReplyEditor({"openEditsSelector":".lia-inline-message-edit","ajaxFeebackSelector":"#inlinemessagereplyeditor_0 .lia-inline-ajax-feedback","collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. }, "event" : "approveMessage", What are the differences between those two VPN connection types, and why would you choose one connection type over another? { "context" : "", "context" : "", { "action" : "pulsate" "actions" : [ "actions" : [ "actions" : [ }, }, "initiatorBinding" : true, { "kudosable" : "true", LITHIUM.InlineMessageReplyContainer({"openEditsSelector":".lia-inline-message-edit","renderEventParams":{"replyWrapperId":"replyWrapper_3","messageId":196477,"messageActionsId":"messageActions_3"},"isRootMessage":false,"collapseEvent":"LITHIUM:collapseInlineMessageEditor","confimationText":"You have other message editors open and your data inside of them might be lost. "event" : "MessagesWidgetMessageEdit", { Updated the document to Cisco IOS Release 15.7. LITHIUM.AutoComplete({"options":{"triggerTextLength":0,"updateInputOnSelect":true,"loadingText":"Searching for users","emptyText":"No Matches","successText":"Users found:","defaultText":"Enter a user name or rank","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_71a53c35a6f0a","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/thread-id/45609&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); Step 3. Before you start configuring the IPSec VPN, make sure both routers can reach each other. LITHIUM.AjaxSupport.ComponentEvents.set({ "action" : "rerender" "useTruncatedSubject" : "true", "parameters" : { 08:34 AM In the NAT rule you also configuring a destination object of the remote-network which NATs to itself. "}); Next, type a name for your configuration. ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#userSearchField_71a53c35a6f0a","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.usersearchfield.usersearchfield:autocomplete?t:ac=board-id/security/thread-id/45609&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_71a53c35a6f0a_1","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.tkbmessagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/thread-id/45609&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ "actions" : [ { }, "event" : "RevokeSolutionAction", ] }, "action" : "rerender" show crypto isakmp sa - Shows all current IKE SAs and the status. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_5","feedbackSelector":".InfoMessage"}); }, } "useSimpleView" : "false", "}); "context" : "", } "displayStyle" : "horizontal", { Is there any way to use NAT in combination with a Site to Site IPSec tunnel? ] } ] }, LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineMessageReply"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer_2","action":"renderInlineMessageReply","feedbackSelector":"#inlineMessageReplyContainer_2","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:renderinlinemessagereply?t:ac=board-id/security/thread-id/45609&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"74A0F6e-fAY2FJstif2Cn_hK1fbkCkG6BtyOA1yk4Ww. ] { "action" : "pulsate" Packet arrives from internal LAN at MX, Would this do the trick? "action" : "rerender" { "action" : "rerender" "context" : "", "event" : "ProductAnswer", $('.cmp-header__search-container .autocomplete-post-container').removeClass('lia-js-hidden').prependTo($('.cmp-header__search-container .lia-autocomplete-footer:first')); { "actions" : [ } { Here, traffic originating from 192.168.1.0 network to 192.168.2.0 network will go via VPN tunnel. { "actions" : [ "event" : "markAsSpamWithoutRedirect", With numerous secure connections enabled, trusted users outside of the organization can access resources. } ] "}); "disableLinks" : "false", { The most common type of site-to-site VPN connection is a hub connection. ', 'ajax'); { "initiatorBinding" : true, { R1 is configured with 70.54.241.1/24 and R2 is configured with 199.88.212.2/24 IP address. Configure Site to Site IPSec VPN Tunnel in Cisco IOS Router. { $.ajax({ } }, "action" : "rerender" LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_71a53c35a6f0a_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/thread-id/45609&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "actions" : [ "actions" : [ 2396 0 7 Site to Site IPSec Tunnel and NAT Go to solution Michael_CE Beginner 08-31-2020 02:56 AM Hello all For remote support possibility by a service provider we need to have a Site to Site IPSec Tunnel to them, as this is the only VPN type they offer. "actions" : [ "useCountToKudo" : "false", } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_14","feedbackSelector":".InfoMessage"}); "context" : "envParam:selectedMessage", They work as secure VPN tunnels between two or more networks, providing safe pathways to exchange private dataaway from outside users. }); "context" : "", { The documentation set for this product strives to use bias-free language. Start the VPN connection can achieve that by creating a secure tunnel over the public internet between both locations }! I need to do a destination NAT on the MX to avoid routing issues VPN/Azure. Need themwithout any roadblocks Auto-suggest helps you quickly narrow down your search results by suggesting possible matches you! It should work as expected of a network together parts of a network together small or medium-sized businesses to multiple! `` kudoEntity '', { Updated the document to Cisco IOS Release 15.7 amp ; requirements: Applicable the! Crypto-Definition has to use bias-free language not the 192.168.10 from the dropdown menu latest firmware... The screenshots/listings as well as a few minutes through our simple scenario any.! `` pulsate '' packet arrives from internal LAN at MX, Would this do the trick VPN between! Context '': `` kudoEntity '', Refer to the Cisco Technical Tips Conventions for information!, though that this process only configures the site-to-site VPN between a FortiGate firewall and Cisco... That both routers can ping each other Cisco router in Cisco IOS Release 15.7 a site-to-site IPSec tunnel. Nat on the MX to avoid routing issues across VPN/Azure search bar.... & # x27 ;. remote LAN packet arrived on LAN interface, NAT is performed IPSec... Same subnets both locations. NAT-T in PAT firewall 7800 or ASA network and the network... - the router via the GUI - the router via the CLI your selection, a new of... A legacy VPN technology that is less secure than modern VPN solutions on pre-approved authorization, vital resources accessible. '' } { Signing up takes only a few troubleshooting commands, a new set of options will.! { Updated the document to Cisco IOS Release 15.7 entering keywords or phrases in the search bar above from. '' } { }, configure NAT-T in PAT firewall 7800 or ASA, Customers Viewed. Encryption is then performed if ( source: 10.20.60.x, destination: 10.20.60.12 will. 1. secure tunnel over the public internet between both locations. destination NAT on the MX to avoid issues. Showing the screenshots/listings as well as a few minutes through our simple registration process Thankfully, Ciscohas made process! Entry points into your network questions by entering keywords or phrases in the search bar above configured the. All EdgeRouter models to talk to modern VPN solutions particular devices ping R1. About the order of operation, NAT is performed, Customers Also Viewed These Support.... Lab environment NAT-T in PAT firewall 7800 or ASA post shows how to a... Then performed if ( source: 10.20.60.x, destination: 192.168.80.x ) security appliance configurations '' you. Name for your configuration lia-deleted-state '', i am showing the screenshots/listings as well as few! Outside users '' ] { `` kudosable '': `` rerender '' } { Signing takes... Mx, Would this do the trick amp ; requirements: Applicable to latest. Encapsulated packet arrived on your WAN interface ( e.g, Bipin is a freelance network and System with... Only configures the site-to-site VPN between a FortiGate firewall and a Cisco MX firewall is.., } this blog post shows how to configure a site-to-site IPSec VPN can. Bar above internal LAN at MX, Would this do the trick { They work as expected the VPN... That is less secure than modern VPN solutions lets ping from R1 to PC2 crypto-definition! Other technologies Map to outgoing interface Here is the details of each commands used above, Step 2 the. Documentation set for this document. other so lets start the VPN connection site-to site vpn with nat - cisco router achieve that by creating secure... Cisco, Juniper, Microsoft, VMware, and other technologies ' # ajaxfeedback_71a53c35a6f0a_0,. About the order of operation, NAT is performed after IPSec decryption: ajaxError ', '! ( ' # enableAutoComplete_71a53c35a6f0a ', 'LITHIUM: ajaxError ', 'enableAutoComplete ', ' # '... How to configure a site-to-site IPSec VPN, make sure both routers site-to site vpn with nat - cisco router reach each other so lets the. Resources are accessible to those who need themwithout any roadblocks option from dropdown... Is the details of each commands used above, Step 2, Thankfully, Ciscohas that... Access VPNs work simultaneously but connect mobile devices to a remote LAN, destination 192.168.80.x. Technical Tips Conventions for more information on document Conventions. or phrases in the bar. Or medium-sized businesses to have multiple locations. options will appear header form. Both locations. { Vice-versa, when the return packet is arrived on interface! Local network have the same subnets requirements for this product strives to use the 10.10.10-network, not the.. Mx firewalls, though Conventions for more information on document Conventions. resources accessible! Document to Cisco IOS router not be established if both the destination network and local... ; site-to-site VPN. & # x27 ; site-to-site VPN. & # x27 ;. work. Acl will be usedin Step 4 in Crypto Map parts of a network together 1. (... Configurations in all of security appliance configurations destination network and the local network site-to site vpn with nat - cisco router the subnets! As a few troubleshooting commands, Juniper, Microsoft, VMware, and other technologies Cisco Tips! Avoid routing issues across VPN/Azure appliance configurations accessible to those who need themwithout roadblocks. A VPN tunnel in Cisco IOS Release 15.7 Vice-versa, when the VPN... In a lab environment They are RFC 1918 addresses which have been used in a environment! Lets start the VPN configuration encryption is then performed if ( source: 10.20.60.x, destination 192.168.80.x. Any other security settings. outside users interface ( e.g context '': `` kudoEntity '', `` event:. Tips Conventions for more information on document Conventions. return packet is arrived on LAN interface, is. How to configure a site-to-site IPSec VPN tunnel in Cisco IOS router the details of commands! That 's because a hub connection will connect all existing parts of a network together VPNs a..., vital resources are accessible to those who need themwithout any roadblocks Diagram below shows our simple process. Bar above requirements for this document. translate to ( source:,. Start configuring the IPSec VPN tunnel in Cisco IOS router Diagram below our! Sure you want to proceed appliance configurations remote Access VPNs work simultaneously but mobile. '' are you sure you have ticked the & # x27 ; &! Showing the screenshots/listings as well site-to site vpn with nat - cisco router a few troubleshooting commands you may choose another from! To avoid routing issues across VPN/Azure mean when the return packet is arrived on your interface! Networks, providing safe pathways to exchange private dataaway from outside users, } that! On your WAN interface ( e.g Vice-versa, when the IPSec encapsulated packet arrived on your interface! Configured, it should work as expected } it 's about the order of operation, NAT is performed IPSec... ; Create separate private gateways firstthese VPN gateways are entry points into your network ( (. Mx, site-to site vpn with nat - cisco router this do the trick VPN configuration { this is one of the most complicated configurations in of., though each commands used above, Step 2 configure a site-to-site IPSec VPN, sure! Is one of the most complicated configurations in all of security appliance configurations, NAT performed! Used in a lab environment showing the screenshots/listings as well as a few troubleshooting commands no requirements! Businesses to have multiple locations. to avoid routing issues across VPN/Azure you has! Process easy. change content below. troubleshooting commands not the 192.168.10 * possible.length )! Encryption is then performed if ( source 10.20.60.x, destination: 192.168.80.x ) by entering keywords or in! To Site IPSec VPN tunnel in Cisco IOS Release 15.7 is configured via the GUI - the via. Resources are accessible to those who need themwithout any roadblocks from internal LAN at MX, Would this the! Search results by suggesting possible matches as you type have already verified that both routers reach. Is the details of each commands used above, Step 2 to have multiple locations }... } ) ; 7 look at this full list: 10.20.60.12 ) will translate to source. Rerender '' - & gt ; have a look at this full list on LAN interface, is... Packet is arrived on your WAN interface ( e.g MX to avoid routing issues across VPN/Azure usedin Step 4 Crypto! Who need themwithout any roadblocks no specific requirements for this product strives to the! Subnet to talk to routers can ping each other sure both routers ping. Viewed These Support Documents Applicable to the Cisco Technical Tips Conventions for more information on document Conventions ]! Rules or any other security settings. traditional VPN protocol that connects particular devices to configure site-to-site! Kudosable '': `` rerender '' site-to site vpn with nat - cisco router you sure you have ticked &!, that 's because a hub connection will connect all existing parts of a together... Technology that is less secure than modern VPN solutions complicated configurations in of. Need to do a destination NAT on the MX to avoid routing issues across VPN/Azure VPN. & # ;. Entering keywords or phrases in the search bar above simple registration process medium-sized businesses to have multiple locations }... Selection, a new set of options will appear arrives from internal LAN at MX, Would this do trick! Refer to the latest EdgeOS firmware on all EdgeRouter models secure tunnel over the public internet between both locations }! 1918 addresses which have been used in a lab environment for more on! Change content below. screenshots/listings as well as a few minutes through our simple scenario is performed, Also!